PDB entry 3amy

View 3amy on RCSB PDB site
Description: Crystal structure of human CK2 alpha complexed with apigenin
Class: Transferase
Keywords: Transferase, ATP-BINDING
Deposited on 2010-08-25, released 2011-10-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.269
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3amya_
  • Heterogens: AGI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3amyA (A:)
    gplgsmsgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfe
    ainitnnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfeh
    vnntdfkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlid
    wglaefyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhg
    hdnydqlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvsp
    ealdfldkllrydhqsrltareamehpyfytvvkdqarmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3amyA (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklsevfeainitnnekvv
    vkilkpvkkkkikreikilenlrggpniitladivkdtpalvfehvnntdfkqlyqtltd
    ydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyhpgqeynv
    rvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlvriakvlg
    tedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldkllrydhq
    srltareamehpyfytvv