PDB entry 3amf

View 3amf on RCSB PDB site
Description: E13R mutant of FMN-binding protein from Desulfovibrio vulgaris (Miyazaki F)
Class: electron transport
Keywords: electron transport
Deposited on 2010-08-19, released 2011-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fmn-binding protein
    Species: Desulfovibrio vulgaris [TaxId:883]
    Gene: DvMF_2023
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46604 (0-121)
      • engineered mutation (12)
    Domains in SCOPe 2.08: d3amfa_
  • Chain 'B':
    Compound: fmn-binding protein
    Species: Desulfovibrio vulgaris [TaxId:883]
    Gene: DvMF_2023
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46604 (0-121)
      • engineered mutation (12)
    Domains in SCOPe 2.08: d3amfb_
  • Heterogens: FMN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3amfA (A:)
    mlpgtffevlknrgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3amfB (B:)
    mlpgtffevlknrgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tl