PDB entry 3am9

View 3am9 on RCSB PDB site
Description: Complex of bovine xanthine dehydrogenase and trihydroxy FYX-051
Class: oxidoreductase
Keywords: xanthine oxidoreductase, xanthine dehydrogenase, FYX-051, OXIDOREDUCTASE
Deposited on 2010-08-18, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.177
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3am9A (A:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqas
    tlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfg
    aacalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisd
    lnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsa
    fkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwne
    kllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkdskdkcgkldp
    tytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddiprye
    nelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfakdtv
    tcvghiigavvadtpehaeraahvvkvtyedlpaiitiedaiknnsfygselkiekgdlk
    kgfseadnvvsgelyiggqdhfylethctiaipkgeegemelfvstqnamktqsfvakml
    gvpvnrilvrvkrmgggfggketrstlvsvavalaayktghpvrcmldrnedmlitggrh
    pflarykvgfmktgtivalevdhysnagnsrdlshsimeralfhmdncykipnirgtgrl
    cktnlssntafrgfggpqalfiaenwmsevavtcglpaeevrwknmykegdlthfnqrle
    gfsvprcwdeclkssqyyarksevdkfnkencwkkrglciiptkfgisftvpflnqagal
    ihvytdgsvlvshggtemgqglhtkmvqvaskalkipiskiyisetstntvpnssptaas
    vstdiygqavyeacqtilkrlepfkkknpdgswedwvmaayqdrvslsttgfyrtpnlgy
    sfetnsgnafhyftygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafv
    qglglftleelhyspegslhtrgpstykipafgsiptefrvsllrdcpnkkaiyaskavg
    epplflgasvffaikdairaaraqhtnnntkelfrldspatpekirnacvdkfttlcvtg
    apgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3am9A (A:)
    adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
    dkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgivm
    smytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfakspslfnpeefmpldptq
    epifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiem
    kfknqlfpmiicpawipelnavehgpegisfgaacalssvektlleavaklptqktevfr
    gvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdht
    ffpsyrktllgpeeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmq
    vkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefr
    rtltlsfffkfyltvlkklgkdkldptytsatllfqkhppaniqlfqevpngqskedtvg
    rplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpgfvcf
    lsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtyedlpa
    iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
    geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
    aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
    hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
    glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
    krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
    kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
    dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
    rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
    iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
    rldspatpekirnacvdkfttlcvtgkpwslrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3am9B (B:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqas
    tlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfg
    aacalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisd
    lnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsa
    fkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwne
    kllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkdskdkcgkldp
    tytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddiprye
    nelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfakdtv
    tcvghiigavvadtpehaeraahvvkvtyedlpaiitiedaiknnsfygselkiekgdlk
    kgfseadnvvsgelyiggqdhfylethctiaipkgeegemelfvstqnamktqsfvakml
    gvpvnrilvrvkrmgggfggketrstlvsvavalaayktghpvrcmldrnedmlitggrh
    pflarykvgfmktgtivalevdhysnagnsrdlshsimeralfhmdncykipnirgtgrl
    cktnlssntafrgfggpqalfiaenwmsevavtcglpaeevrwknmykegdlthfnqrle
    gfsvprcwdeclkssqyyarksevdkfnkencwkkrglciiptkfgisftvpflnqagal
    ihvytdgsvlvshggtemgqglhtkmvqvaskalkipiskiyisetstntvpnssptaas
    vstdiygqavyeacqtilkrlepfkkknpdgswedwvmaayqdrvslsttgfyrtpnlgy
    sfetnsgnafhyftygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafv
    qglglftleelhyspegslhtrgpstykipafgsiptefrvsllrdcpnkkaiyaskavg
    epplflgasvffaikdairaaraqhtnnntkelfrldspatpekirnacvdkfttlcvtg
    apgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3am9B (B:)
    adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
    dkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgivm
    smytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfakspslfnpeefmpldptq
    epifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiem
    kfknqlfpmiicpawipelnavehgpegisfgaacalssvektlleavaklptqktevfr
    gvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdht
    ffpsyrktllgpeeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmq
    vkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefr
    rtltlsfffkfyltvlkklgkldptytsatllfqkhppaniqlfqevpngqskedtvgrp
    lphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpgfvcfls
    addipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtyedlpaii
    tiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipkge
    egemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvavalaa
    yktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdlshs
    imeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtcgl
    paeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwkkr
    glciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskalki
    piskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswedw
    vmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknlrt
    divmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgsip
    tefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelfrl
    dspatpekirnacvdkfttlcvnckpwslrv