PDB entry 3als

View 3als on RCSB PDB site
Description: Crystal structure of CEL-IV
Class: sugar binding protein
Keywords: CEL-IV, C-type lectin, SUGAR BINDING PROTEIN
Deposited on 2010-08-07, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.197
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lectin CEL-IV, C-type
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3alsa_
  • Chain 'B':
    Compound: Lectin CEL-IV, C-type
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3alsb_
  • Chain 'C':
    Compound: Lectin CEL-IV, C-type
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3alsc_
  • Chain 'D':
    Compound: Lectin CEL-IV, C-type
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3alsd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3alsA (A:)
    cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
    afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
    rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3alsA (A:)
    ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
    fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
    gaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3alsB (B:)
    cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
    afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
    rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3alsB (B:)
    ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
    fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
    gaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3alsC (C:)
    cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
    afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
    rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3alsC (C:)
    ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
    fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
    gaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3alsD (D:)
    cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
    afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
    rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3alsD (D:)
    ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
    fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
    gaiaagdysrgfwadvysnnnfkyicqlpcvhytle