PDB entry 3alq

View 3alq on RCSB PDB site
Description: Crystal structure of TNF-TNFR2 complex
Class: cytokine/cytokine receptor
Keywords: LIGAND-RECEPTOR COMPLEX, CYTOKINE, CYTOKINE-CYTOKINE RECEPTOR complex
Deposited on 2010-08-06, released 2010-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.22
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (10)
      • engineered mutation (64)
      • engineered mutation (89)
      • engineered mutation (97)
      • engineered mutation (111)
      • engineered mutation (127)
    Domains in SCOPe 2.06: d3alqa_
  • Chain 'B':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (10)
      • engineered mutation (64)
      • engineered mutation (89)
      • engineered mutation (97)
      • engineered mutation (111)
      • engineered mutation (127)
    Domains in SCOPe 2.06: d3alqb_
  • Chain 'C':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (10)
      • engineered mutation (64)
      • engineered mutation (89)
      • engineered mutation (97)
      • engineered mutation (111)
      • engineered mutation (127)
    Domains in SCOPe 2.06: d3alqc_
  • Chain 'D':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (10)
      • engineered mutation (64)
      • engineered mutation (89)
      • engineered mutation (97)
      • engineered mutation (111)
      • engineered mutation (127)
    Domains in SCOPe 2.06: d3alqd_
  • Chain 'E':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (10)
      • engineered mutation (64)
      • engineered mutation (89)
      • engineered mutation (97)
      • engineered mutation (111)
      • engineered mutation (127)
    Domains in SCOPe 2.06: d3alqe_
  • Chain 'F':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (10)
      • engineered mutation (64)
      • engineered mutation (89)
      • engineered mutation (97)
      • engineered mutation (111)
      • engineered mutation (127)
    Domains in SCOPe 2.06: d3alqf_
  • Chain 'R':
    Compound: Tumor necrosis factor receptor superfamily member 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFBR, TNFR2, TNFRSF1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Tumor necrosis factor receptor superfamily member 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFBR, TNFR2, TNFRSF1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Tumor necrosis factor receptor superfamily member 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFBR, TNFR2, TNFRSF1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Tumor necrosis factor receptor superfamily member 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFBR, TNFR2, TNFRSF1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Tumor necrosis factor receptor superfamily member 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFBR, TNFR2, TNFRSF1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Tumor necrosis factor receptor superfamily member 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFBR, TNFR2, TNFRSF1B
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3alqA (A:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3alqA (A:)
    sdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgqg
    cpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsaei
    nrpdyldfaesgqvyfgiial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3alqB (B:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3alqB (B:)
    sdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgqg
    cpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsaei
    nrpdyldfaesgqvyfgiial
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3alqC (C:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3alqC (C:)
    sdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgqg
    cpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsaei
    nrpdyldfaesgqvyfgiial
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3alqD (D:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3alqD (D:)
    sdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgqg
    cpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsaei
    nrpdyldfaesgqvyfgiial
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3alqE (E:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3alqE (E:)
    sdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgqg
    cpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsaei
    nrpdyldfaesgqvyfgiial
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3alqF (F:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3alqF (F:)
    sdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgqg
    cpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsaei
    nrpdyldfaesgqvyfgiial
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.