PDB entry 3al4

View 3al4 on RCSB PDB site
Description: Crystal structure of the swine-origin A (H1N1)-2009 influenza A virus hemagglutinin (HA) reveals similar antigenicity to that of the 1918 pandemic virus
Class: viral protein/viral protein
Keywords: TRIMER, ENVELOPE PROTEIN, HEMAGGLUTININ, VIRAL PROTEIN-VIRAL PROTEIN complex
Deposited on 2010-07-22, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.247
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4c_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4e_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4f_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4g_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4h_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4i_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4j_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4k_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3al4l_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3al4A (A:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4A (A:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3al4B (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4B (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3al4C (C:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4C (C:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3al4D (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4D (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3al4E (E:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4E (E:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3al4F (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4F (F:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3al4G (G:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4G (G:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3al4H (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4H (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3al4I (I:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4I (I:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3al4J (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4J (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3al4K (K:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4K (K:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3al4L (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3al4L (L:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypky