PDB entry 3aky

View 3aky on RCSB PDB site
Description: stability, activity and structure of adenylate kinase mutants
Deposited on 1995-07-28, released 1995-11-14
The last revision prior to the SCOP 1.59 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.149
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aky_ (-)
    esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl
    vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd
    ellvaritgrlihpasgrsyhkifnppkedmkddvtgealvqrsddnadalkkrlaayha
    qtepivdfykktgiwagvdasqppatvwadflnklgkn