PDB entry 3aky

View 3aky on RCSB PDB site
Description: stability, activity and structure of adenylate kinase mutants
Class: adenylate kinase
Keywords: ATP:amp phosphotransferase, myokinase, adenylate kinase
Deposited on 1995-07-28, released 1995-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.149
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07170 (Start-218)
      • engineered (212)
    Domains in SCOPe 2.07: d3akya1, d3akya2
  • Heterogens: AP5, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3akyA (A:)
    ssesirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqg
    glvsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkv
    ddellvaritgrlihpasgrsyhkifnppkedmkddvtgealvqrsddnadalkkrlaay
    haqtepivdfykktgiwagvdasqppatvwadflnklgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3akyA (A:)
    esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl
    vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd
    ellvaritgrlihpasgrsyhkifnppkedmkddvtgealvqrsddnadalkkrlaayha
    qtepivdfykktgiwagvdasqppatvwadflnklgkn