PDB entry 3akn

View 3akn on RCSB PDB site
Description: X-ray structure of iFABP from human and rat with bound fluorescent fatty acid analogue
Class: transport protein
Keywords: beta barrel, lipid binding protein, TRANSPORT PROTEIN
Deposited on 2010-07-14, released 2011-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.226
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, intestinal
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fabp2, Fabpi
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3akna_
  • Heterogens: 11D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3aknA (A:)
afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidv
vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
gveakrifkke

    Sequence, based on observed residues (ATOM records): (download) 
    >3aknA (A:)
afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidv
vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
gveakrifkk