PDB entry 3akc

View 3akc on RCSB PDB site
Description: Crystal structure of CMP kinase in complex with CDP and ADP from Thermus thermophilus HB8
Class: transferase
Keywords: CMP kinase, CDP and ADP complex, closed conformation, nucleotide metabolism, TRANSFERASE
Deposited on 2010-07-12, released 2011-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.199
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidylate kinase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0458
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3akca_
  • Heterogens: CDP, ADP, GD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3akcA (A:)
mrgivtidgpsasgkssvarrvaaalgvpylssgllyraaaflalragvdpgdeegllal
leglgvrllaqaegnrvladgedltsflhtpevdrvvsavarlpgvrawvnrrlkevppp
fvaegrdmgtavfpeaahkfyltaspevrawrrarerpqayeevlrdllrrderdkaqsa
papdalvldtggmtldevvawvlahirr