PDB entry 3ak4

View 3ak4 on RCSB PDB site
Description: Crystal structure of NADH-dependent quinuclidinone reductase from agrobacterium tumefaciens
Class: oxidoreductase
Keywords: sdr, 3-quinuclidinone, (r)-3-quinuclidinol, chiral alcohol, carbonyl reductase, oxidoreductase
Deposited on 2010-07-07, released 2011-07-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.151
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH-dependent quinuclidinone reductase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3AK4 (Start-262)
    Domains in SCOPe 2.05: d3ak4a_
  • Chain 'B':
    Compound: NADH-dependent quinuclidinone reductase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3AK4 (Start-262)
    Domains in SCOPe 2.05: d3ak4b_
  • Chain 'C':
    Compound: NADH-dependent quinuclidinone reductase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3AK4 (Start-262)
    Domains in SCOPe 2.05: d3ak4c_
  • Chain 'D':
    Compound: NADH-dependent quinuclidinone reductase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3AK4 (Start-262)
    Domains in SCOPe 2.05: d3ak4d_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ak4A (A:)
    gshmagifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglengg
    favevdvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnarg
    vflanqiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapk
    nirvncvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvf
    lasdaarfmtgqginvtggvrmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak4A (A:)
    gifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglenggfavev
    dvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnargvflan
    qiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapknirvn
    cvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvflasda
    arfmtgqginvtggvrmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ak4B (B:)
    gshmagifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglengg
    favevdvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnarg
    vflanqiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapk
    nirvncvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvf
    lasdaarfmtgqginvtggvrmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak4B (B:)
    gifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglenggfavev
    dvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnargvflan
    qiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapknirvn
    cvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvflasda
    arfmtgqginvtggvrmd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ak4C (C:)
    gshmagifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglengg
    favevdvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnarg
    vflanqiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapk
    nirvncvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvf
    lasdaarfmtgqginvtggvrmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak4C (C:)
    gifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglenggfavev
    dvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnargvflan
    qiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapknirvn
    cvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvflasda
    arfmtgqginvtggvrmd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ak4D (D:)
    gshmagifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglengg
    favevdvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnarg
    vflanqiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapk
    nirvncvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvf
    lasdaarfmtgqginvtggvrmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak4D (D:)
    gifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglenggfavev
    dvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnargvflan
    qiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapknirvn
    cvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvflasda
    arfmtgqginvtggvrmd