PDB entry 3ajr

View 3ajr on RCSB PDB site
Description: Crystal structure of L-3-Hydroxynorvaline bound L-Threonine dehydrogenase (Y137F) from Hyperthermophilic Archaeon Thermoplasma volcanium
Class: Oxidoreductase
Keywords: L-threonine dehydrogenase, Thermoplasma volcanium, L-3-Hydroxynorvaline, Oxidoreductase
Deposited on 2010-06-14, released 2011-06-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.199
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NDP-sugar epimerase
    Species: Thermoplasma volcanium [TaxId:273116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97BK3 (0-End)
      • engineered mutation (136)
    Domains in SCOPe 2.04: d3ajra_
  • Chain 'B':
    Compound: NDP-sugar epimerase
    Species: Thermoplasma volcanium [TaxId:273116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97BK3 (0-End)
      • engineered mutation (136)
    Domains in SCOPe 2.04: d3ajrb_
  • Heterogens: VAH, NAD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ajrA (A:)
    milvtgssgqigtelvpylaekygkknviasdivqrdtggikfitldvsnrdeidravek
    ysidaifhlagilsakgekdpalaykvnmngtynileaakqhrvekvvipstigvfgpet
    pknkvpsititrprtmfgvtkiaaellgqyyyekfgldvrslrypgiisykaeptagttd
    yaveifyyavkrekykcylapnralpmmympdalkalvdlyeadrdklvlrngynvtayt
    ftpselyskikeripefeieykedfrdkiaatwpesldsseasnewgfsieydldrtidd
    midhiseklgiegkhal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ajrA (A:)
    milvtgssgqigtelvpylaekygkknviasdivqrdtggikfitldvsnrdeidravek
    ysidaifhlagilsakgekdpalaykvnmngtynileaakqhrvekvvipstigvfgpet
    pknkvpsititrprtmfgvtkiaaellgqyyyekfgldvrslrypgiisykaeptagttd
    yaveifyyavkrekykcylapnralpmmympdalkalvdlyeadrdklvlrngynvtayt
    ftpselyskikeripefeieykedfrdkiaatwpesldsseasnewgfsieydldrtidd
    midhiseklgiegk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ajrB (B:)
    milvtgssgqigtelvpylaekygkknviasdivqrdtggikfitldvsnrdeidravek
    ysidaifhlagilsakgekdpalaykvnmngtynileaakqhrvekvvipstigvfgpet
    pknkvpsititrprtmfgvtkiaaellgqyyyekfgldvrslrypgiisykaeptagttd
    yaveifyyavkrekykcylapnralpmmympdalkalvdlyeadrdklvlrngynvtayt
    ftpselyskikeripefeieykedfrdkiaatwpesldsseasnewgfsieydldrtidd
    midhiseklgiegkhal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ajrB (B:)
    milvtgssgqigtelvpylaekygkknviasdivqrdtggikfitldvsnrdeidravek
    ysidaifhlagilsakgekdpalaykvnmngtynileaakqhrvekvvipstigvfgpet
    pknkvpsititrprtmfgvtkiaaellgqyyyekfgldvrslrypgiisykaeptagttd
    yaveifyyavkrekykcylapnralpmmympdalkalvdlyeadrdklvlrngynvtayt
    ftpselyskikeripefeieykedfrdkiaatwpesldsseasnewgfsieydldrtidd
    midhisek