PDB entry 3aj8

View 3aj8 on RCSB PDB site
Description: X-ray analysis of Crystal of Proteinase K Obtained from H2O Solution Using PEG 8000
Class: hydrolase
Keywords: proteinase k, polyethylene glycol, hydrolase
Deposited on 2010-05-27, released 2011-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.119
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinase K
    Species: Tritirachium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06873 (0-278)
      • see remark 999 (206)
    Domains in SCOPe 2.08: d3aj8a_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3aj8A (A:)
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa