PDB entry 3aj4

View 3aj4 on RCSB PDB site
Description: Crystal structure of the PH domain of Evectin-2 from human complexed with O-phospho-L-serine
Deposited on 2010-05-21, released 2011-05-25
The last revision was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.106
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin homology domain-containing family B member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96CS7 (2-111)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Pleckstrin homology domain-containing family B member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96CS7 (2-111)
      • expression tag (0-1)
  • Heterogens: SEP, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3aj4A (A:)
gsmafvksgwllrqstilkrwkknwfdlwsdghliyyddqtrqniedkvhmpmdcinirt
gqecrdtqppdgkskdcmlqivcrdgktislcaestddclawkftlqdsrtn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3aj4B (B:)
gsmafvksgwllrqstilkrwkknwfdlwsdghliyyddqtrqniedkvhmpmdcinirt
gqecrdtqppdgkskdcmlqivcrdgktislcaestddclawkftlqdsrtn