PDB entry 3aiw

View 3aiw on RCSB PDB site
Description: Crystal structure of beta-glucosidase in rye complexed with 2-deoxy-2-fluoroglucoside and dinitrophenol
Class: hydrolase
Keywords: TIM barrel, HYDROLASE
Deposited on 2010-05-18, released 2011-02-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.187
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Secale cereale [TaxId:4550]
    Gene: ScGlu
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FYS3
      • see remark 999 (367)
      • see remark 999 (369)
    Domains in SCOPe 2.06: d3aiwa_
  • Heterogens: DNF, G2F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aiwA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamagtpskpsepigpvf
    tklkpwqipkrdwfskdflfgastsayqiegawnedgkgpstwdhfchtyperisdgtng
    dvaansyhmyeedvkalkdmgmkvyrfsiswsrilpngtgkpnqkgidyynnlinslirh
    givpyvtiwhwdtpqaledkyggfldkqivndykyfaelcfqsfgdrvknwftfnephty
    ccfsygegihapgrcspgldcavpegdslrepytaghhillahaeavelfkahynkhgds
    kigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrlpmft
    keeqeklasscdimglnyytsrfskhvdissdytptlntddayassettgsdgneigpit
    gtywiymypkgltdlllimkekygnppifitengiadvegdpempdplddwkrldylqrh
    isavkdaidqgadvrghftwglidnfewgsgyssrfglvyidkedgnkrklkksakwfak
    fnsvpktllkttnnnatvtasvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aiwA (A:)
    vftklkpwqipkrdwfskdflfgastsayqiegawnedgkgpstwdhfchtyperisdgt
    ngdvaansyhmyeedvkalkdmgmkvyrfsiswsrilpngtgkpnqkgidyynnlinsli
    rhgivpyvtiwhwdtpqaledkyggfldkqivndykyfaelcfqsfgdrvknwftfneph
    tyccfsygegihapgrcspgldcavpegdslrepytaghhillahaeavelfkahynkhg
    dskigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrlpm
    ftkeeqeklasscdimglnyytsrfskhvdissdytptlntddayassettgsdgneigp
    itgtywiymypkgltdlllimkekygnppifitengiadvegdpempdplddwkrldylq
    rhisavkdaidqgadvrghftwglidnfewgsgyssrfglvyidkedgnkrklkksakwf
    akfnsv