PDB entry 3aiu

View 3aiu on RCSB PDB site
Description: Crystal structure of beta-glucosidase in rye
Class: hydrolase
Keywords: TIM barrel, HYDROLASE
Deposited on 2010-05-18, released 2011-02-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Secale cereale [TaxId:4550]
    Gene: ScGlu
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FYS3
      • see remark 999 (367)
      • see remark 999 (369)
    Domains in SCOPe 2.06: d3aiua_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aiuA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamagtpskpsepigpvf
    tklkpwqipkrdwfskdflfgastsayqiegawnedgkgpstwdhfchtyperisdgtng
    dvaansyhmyeedvkalkdmgmkvyrfsiswsrilpngtgkpnqkgidyynnlinslirh
    givpyvtiwhwdtpqaledkyggfldkqivndykyfaelcfqsfgdrvknwftfnephty
    ccfsygegihapgrcspgldcavpegdslrepytaghhillahaeavelfkahynkhgds
    kigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrlpmft
    keeqeklasscdimglnyytsrfskhvdissdytptlntddayassettgsdgneigpit
    gtywiymypkgltdlllimkekygnppifitengiadvegdpempdplddwkrldylqrh
    isavkdaidqgadvrghftwglidnfewgsgyssrfglvyidkedgnkrklkksakwfak
    fnsvpktllkttnnnatvtasvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aiuA (A:)
    vftklkpwqipkrdwfskdflfgastsayqiegawnedgkgpstwdhfchtyperisdgt
    ngdvaansyhmyeedvkalkdmgmkvyrfsiswsrilpngtgkpnqkgidyynnlinsli
    rhgivpyvtiwhwdtpqaledkyggfldkqivndykyfaelcfqsfgdrvknwftfneph
    tyccfsygegihapgrcspgldcavpegdslrepytaghhillahaeavelfkahynkhg
    dskigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrlpm
    ftkeeqeklasscdimglnyytsrfskhvdissdytptlntddayassettgsdgneigp
    itgtywiymypkgltdlllimkekygnppifitengiadvegdpempdplddwkrldylq
    rhisavkdaidqgadvrghftwglidnfewgsgyssrfglvyidkedgnkrklkksakwf
    akfnsv