PDB entry 3aiq

View 3aiq on RCSB PDB site
Description: Crystal structure of beta-glucosidase in wheat complexed with an aglycone DIMBOA
Class: hydrolase
Keywords: TIM barrel, glycosidases, HYDROLASE
Deposited on 2010-05-18, released 2011-02-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Gene: Taglu1b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aiqa_
  • Heterogens: HBO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aiqA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamagtpskpaepigpvf
    tklkpwqipkrdwfdkdflfgastsayqiegawnedgkgpstwdhfchtyperisdmtng
    dvaansyhlyeedvkalkdmgmkvyrfsiswsrilpdgtgkvnqagidyynklinslidn
    divpyvtiwhwdtpqaledkyggflnrqivddykqfaevcfknfgdrvknwftfnephty
    ccfsygegihapgrcspgmdcavpegdslrepytaghhillahaeavqlfkarynmhgds
    kigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrlpmft
    keeqeklasscdimglnyytsrfskhvdmspdftptlntddayassettgsdgndigpit
    gtywiymypkgltdlllimkekygnppvfitengiadvegdesmpdplddwkrldylqrh
    isavkdaidqgadvrghftwglidnfewslgyssrfglvyidkndgnkrklkksakwfsk
    fnsvpkpllkttnnnatmtaasvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aiqA (A:)
    gpvftklkpwqipkrdwfdkdflfgastsayqiegawnedgkgpstwdhfchtyperisd
    mtngdvaansyhlyeedvkalkdmgmkvyrfsiswsrilpdgtgkvnqagidyynklins
    lidndivpyvtiwhwdtpqaledkyggflnrqivddykqfaevcfknfgdrvknwftfne
    phtyccfsygegihapgrcspgmdcavpegdslrepytaghhillahaeavqlfkarynm
    hgdskigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrl
    pmftkeeqeklasscdimglnyytsrfskhvdmspdftptlntddayassettgsdgndi
    gpitgtywiymypkgltdlllimkekygnppvfitengiadvegdesmpdplddwkrldy
    lqrhisavkdaidqgadvrghftwglidnfewslgyssrfglvyidkndgnkrklkksak
    wfskfnsvpkp