PDB entry 3aig

View 3aig on RCSB PDB site
Description: adamalysin ii with peptidomimetic inhibitor pol656
Deposited on 1997-10-12, released 1998-04-15
The last revision prior to the SCOP 1.69 freeze date was dated 1998-04-15, with a file datestamp of 1998-04-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d3aig__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >3aig_ (-)
    xnlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiws
    gqdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnpr
    ssvgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsd
    dsmgyyqkflnqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aig_ (-)
    nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
    qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
    svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
    smgyyqkflnqykpqcilnkp