PDB entry 3aid

View 3aid on RCSB PDB site
Description: a new class of hiv-1 protease inhibitor: the crystallographic structure, inhibition and chemical synthesis of an aminimide peptide isostere
Class: aspartyl protease
Keywords: aspartyl protease, protease, hiv, peptide isostere inhibitor, drug design
Deposited on 1997-05-15, released 1997-09-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human immunodeficiency virus protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
  Domains in SCOPe 2.05: d3aida_
• Chain 'B':
  Compound: human immunodeficiency virus protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
  Domains in SCOPe 2.05: d3aidb_
• Heterogens: ARQ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3aidA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3aidB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf