PDB entry 3ai2

View 3ai2 on RCSB PDB site
Description: The crystal structure of L-sorbose reductase from Gluconobacter frateurii complexed with NADPH
Class: oxidoreductase
Keywords: Rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, OXIDOREDUCTASE
Deposited on 2010-05-07, released 2011-02-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH-sorbose reductase
    Species: Gluconobacter frateurii [TaxId:38308]
    Gene: sboA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ai2a_
  • Chain 'B':
    Compound: NADPH-sorbose reductase
    Species: Gluconobacter frateurii [TaxId:38308]
    Gene: sboA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ai2b_
  • Chain 'C':
    Compound: NADPH-sorbose reductase
    Species: Gluconobacter frateurii [TaxId:38308]
    Gene: sboA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ai2c_
  • Chain 'D':
    Compound: NADPH-sorbose reductase
    Species: Gluconobacter frateurii [TaxId:38308]
    Gene: sboA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ai2d_
  • Chain 'E':
    Compound: NADPH-sorbose reductase
    Species: Gluconobacter frateurii [TaxId:38308]
    Gene: sboA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ai2e_
  • Chain 'F':
    Compound: NADPH-sorbose reductase
    Species: Gluconobacter frateurii [TaxId:38308]
    Gene: sboA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ai2f_
  • Chain 'G':
    Compound: NADPH-sorbose reductase
    Species: Gluconobacter frateurii [TaxId:38308]
    Gene: sboA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ai2g_
  • Chain 'H':
    Compound: NADPH-sorbose reductase
    Species: Gluconobacter frateurii [TaxId:38308]
    Gene: sboA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ai2h_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ai2A (A:)
    mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
    evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
    vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
    rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
    cseratysvgsayfvdggmlktl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ai2B (B:)
    mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
    evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
    vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
    rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
    cseratysvgsayfvdggmlktl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ai2C (C:)
    mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
    evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
    vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
    rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
    cseratysvgsayfvdggmlktl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ai2D (D:)
    mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
    evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
    vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
    rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
    cseratysvgsayfvdggmlktl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ai2E (E:)
    mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
    evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
    vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
    rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
    cseratysvgsayfvdggmlktl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ai2F (F:)
    mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
    evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
    vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
    rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
    cseratysvgsayfvdggmlktl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ai2G (G:)
    mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
    evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
    vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
    rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
    cseratysvgsayfvdggmlktl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ai2H (H:)
    mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
    evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
    vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
    rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
    cseratysvgsayfvdggmlktl