PDB entry 3ai1

View 3ai1 on RCSB PDB site
Description: The crystal structure of L-sorbose reductase from Gluconobacter frateurii complexed with NADPH and L-sorbose reveals the structure bases of its catalytic mechanism and high substrate selectivity
Class: oxidoreductase
Keywords: Rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, OXIDOREDUCTASE
Deposited on 2010-05-06, released 2011-02-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.21
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH-sorbose reductase
    Species: Gluconobacter frateurii [TaxId:38308]
    Gene: sboA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ai1a_
  • Chain 'B':
    Compound: NADPH-sorbose reductase
    Species: Gluconobacter frateurii [TaxId:38308]
    Gene: sboA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ai1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ai1A (A:)
    mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
    evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
    vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
    rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
    cseratysvgsayfvdggmlktl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ai1B (B:)
    mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
    evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
    vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
    rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
    cseratysvgsayfvdggmlktl