PDB entry 3ahx

View 3ahx on RCSB PDB site
Description: Crystal structure of beta-glucosidase A from bacterium Clostridium cellulovorans
Class: hydrolase
Keywords: cellulases, glycosyl hydrolase, manganese enhancement, HYDROLASE
Deposited on 2010-05-06, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.149
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ahxa_
  • Chain 'B':
    Compound: beta-glucosidase a
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ahxb_
  • Chain 'C':
    Compound: beta-glucosidase a
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ahxc_
  • Chain 'D':
    Compound: beta-glucosidase a
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ahxd_
  • Heterogens: 7PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ahxA (A:)
    meklrfpkdfifgtataayqiegaykedekgesiwdrfshipgnvakmhngdiacdhyhr
    ykedvqllkslgiksyrfsiawprifpkgfgeinqkgiqfyrdlidelikndiepaitiy
    hwdlpqklqdiggwanpqvadyyvdyanllfrefgdrvktwithnepwvasylgyalgvh
    apgikdmkmallaahnillshfkavkayreleqdgqigitlnlstcysnsadeediaaah
    rsdgwnnrwfldaalkgtypedmikifsdtnimpelpkelftevfetsdflginyytrqv
    vknnseafigaesvamdnpktemgweiypqglydlltrihrdygnidlyitengaafndm
    vnrdgkvedenrldylythfaaalsaieagvplkgyyiwsfmdnfewaegyekrfgivhv
    nyktqertikksaywykeliersnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ahxA (A:)
    meklrfpkdfifgtataayqiegaykedekgesiwdrfshipgnvakmhngdiacdhyhr
    ykedvqllkslgiksyrfsiawprifpkgfgeinqkgiqfyrdlidelikndiepaitiy
    hwdlpqklqdiggwanpqvadyyvdyanllfrefgdrvktwithnepwvasylgyalgvh
    apgikdmkmallaahnillshfkavkayreleqdgqigitlnlstcysnsadeediaaah
    rsdgwnnrwfldaalkgtypedmikifsdtnimpelpkelftevfetsdflginyytrqv
    vknnseafigaesvamdnpktemgweiypqglydlltrihrdygnidlyitengaafndm
    vnrdgkvedenrldylythfaaalsaieagvplkgyyiwsfmdnfewaegyekrfgivhv
    nyktqertikksaywykeliersn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ahxB (B:)
    meklrfpkdfifgtataayqiegaykedekgesiwdrfshipgnvakmhngdiacdhyhr
    ykedvqllkslgiksyrfsiawprifpkgfgeinqkgiqfyrdlidelikndiepaitiy
    hwdlpqklqdiggwanpqvadyyvdyanllfrefgdrvktwithnepwvasylgyalgvh
    apgikdmkmallaahnillshfkavkayreleqdgqigitlnlstcysnsadeediaaah
    rsdgwnnrwfldaalkgtypedmikifsdtnimpelpkelftevfetsdflginyytrqv
    vknnseafigaesvamdnpktemgweiypqglydlltrihrdygnidlyitengaafndm
    vnrdgkvedenrldylythfaaalsaieagvplkgyyiwsfmdnfewaegyekrfgivhv
    nyktqertikksaywykeliersnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ahxB (B:)
    meklrfpkdfifgtataayqiegaykedekgesiwdrfshipgnvakmhngdiacdhyhr
    ykedvqllkslgiksyrfsiawprifpkgfgeinqkgiqfyrdlidelikndiepaitiy
    hwdlpqklqdiggwanpqvadyyvdyanllfrefgdrvktwithnepwvasylgyalgvh
    apgikdmkmallaahnillshfkavkayreleqdgqigitlnlstcysnsadeediaaah
    rsdgwnnrwfldaalkgtypedmikifsdtnimpelpkelftevfetsdflginyytrqv
    vknnseafigaesvamdnpktemgweiypqglydlltrihrdygnidlyitengaafndm
    vnrdgkvedenrldylythfaaalsaieagvplkgyyiwsfmdnfewaegyekrfgivhv
    nyktqertikksaywykeliersn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ahxC (C:)
    meklrfpkdfifgtataayqiegaykedekgesiwdrfshipgnvakmhngdiacdhyhr
    ykedvqllkslgiksyrfsiawprifpkgfgeinqkgiqfyrdlidelikndiepaitiy
    hwdlpqklqdiggwanpqvadyyvdyanllfrefgdrvktwithnepwvasylgyalgvh
    apgikdmkmallaahnillshfkavkayreleqdgqigitlnlstcysnsadeediaaah
    rsdgwnnrwfldaalkgtypedmikifsdtnimpelpkelftevfetsdflginyytrqv
    vknnseafigaesvamdnpktemgweiypqglydlltrihrdygnidlyitengaafndm
    vnrdgkvedenrldylythfaaalsaieagvplkgyyiwsfmdnfewaegyekrfgivhv
    nyktqertikksaywykeliersnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ahxC (C:)
    lrfpkdfifgtataayqiegaykedekgesiwdrfshipgnvakmhngdiacdhyhryke
    dvqllkslgiksyrfsiawprifpkgfgeinqkgiqfyrdlidelikndiepaitiyhwd
    lpqklqdiggwanpqvadyyvdyanllfrefgdrvktwithnepwvasylgyalgvhapg
    ikdmkmallaahnillshfkavkayreleqdgqigitlnlstcysnsadeediaaahrsd
    gwnnrwfldaalkgtypedmikifsdtnimpelpkelftevfetsdflginyytrqvvkn
    nseafigaesvamdnpktemgweiypqglydlltrihrdygnidlyitengaafndmvnr
    dgkvedenrldylythfaaalsaieagvplkgyyiwsfmdnfewaegyekrfgivhvnyk
    tqertikksaywykeliersn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ahxD (D:)
    meklrfpkdfifgtataayqiegaykedekgesiwdrfshipgnvakmhngdiacdhyhr
    ykedvqllkslgiksyrfsiawprifpkgfgeinqkgiqfyrdlidelikndiepaitiy
    hwdlpqklqdiggwanpqvadyyvdyanllfrefgdrvktwithnepwvasylgyalgvh
    apgikdmkmallaahnillshfkavkayreleqdgqigitlnlstcysnsadeediaaah
    rsdgwnnrwfldaalkgtypedmikifsdtnimpelpkelftevfetsdflginyytrqv
    vknnseafigaesvamdnpktemgweiypqglydlltrihrdygnidlyitengaafndm
    vnrdgkvedenrldylythfaaalsaieagvplkgyyiwsfmdnfewaegyekrfgivhv
    nyktqertikksaywykeliersnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ahxD (D:)
    eklrfpkdfifgtataayqiegaykedekgesiwdrfshipgnvakmhngdiacdhyhry
    kedvqllkslgiksyrfsiawprifpkgfgeinqkgiqfyrdlidelikndiepaitiyh
    wdlpqklqdiggwanpqvadyyvdyanllfrefgdrvktwithnepwvasylgyalgvha
    pgikdmkmallaahnillshfkavkayreleqdgqigitlnlstcysnsadeediaaahr
    sdgwnnrwfldaalkgtypedmikifsdtnimpelpkelftevfetsdflginyytrqvv
    knnseafigaesvamdnpktemgweiypqglydlltrihrdygnidlyitengaafndmv
    nrdgkvedenrldylythfaaalsaieagvplkgyyiwsfmdnfewaegyekrfgivhvn
    yktqertikksaywykeliersn