PDB entry 3ah7
View 3ah7 on RCSB PDB site
Description: Crystal structure of the ISC-like [2Fe-2S] ferredoxin (FdxB) from Pseudomonas putida JCM 20004
Class: metal binding protein
Keywords: ferredoxin, [2Fe-2S] cluster, iron-sulfur cluster biosynthesis, Pseudomonas, METAL BINDING PROTEIN
Deposited on
2010-04-20, released
2011-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-04-20, with a file datestamp of
2011-04-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: [2Fe-2S]ferredoxin
Species: Pseudomonas putida [TaxId:303]
Gene: fdxB
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3ah7a1, d3ah7a2 - Heterogens: FES, NA, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3ah7A (A:)
mplvtflphekfcpegltvevkpgtnilelahdhhiemesacggvkacttchcivrkgfd
sleeadeleedmldkawgleaqsrlgcqvfvadedltieipkyslnhaaeaph
Sequence, based on observed residues (ATOM records): (download)
>3ah7A (A:)
mplvtflphekfcpegltvevkpgtnilelahdhhiemesacggvkacttchcivrkgfd
sleeadeleedmldkawgleaqsrlgcqvfvadedltieipkyslnhaa