PDB entry 3ah7

View 3ah7 on RCSB PDB site
Description: Crystal structure of the ISC-like [2Fe-2S] ferredoxin (FdxB) from Pseudomonas putida JCM 20004
Class: metal binding protein
Keywords: ferredoxin, [2Fe-2S] cluster, iron-sulfur cluster biosynthesis, Pseudomonas, METAL BINDING PROTEIN
Deposited on 2010-04-20, released 2011-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: [2Fe-2S]ferredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: fdxB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q76CS9 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3ah7a1, d3ah7a2
  • Heterogens: FES, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ah7A (A:)
    mplvtflphekfcpegltvevkpgtnilelahdhhiemesacggvkacttchcivrkgfd
    sleeadeleedmldkawgleaqsrlgcqvfvadedltieipkyslnhaaeaph
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ah7A (A:)
    mplvtflphekfcpegltvevkpgtnilelahdhhiemesacggvkacttchcivrkgfd
    sleeadeleedmldkawgleaqsrlgcqvfvadedltieipkyslnhaa