PDB entry 3ah4

View 3ah4 on RCSB PDB site
Description: HA1 subcomponent of botulinum type C progenitor toxin complexed with galactose
Class: toxin
Keywords: Toxin, beta trefoil, hemagglutinin
Deposited on 2010-04-13, released 2010-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Main hemagglutinin component
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ah4a1, d3ah4a2
  • Chain 'B':
    Compound: Main hemagglutinin component
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ah4b1, d3ah4b2
  • Heterogens: GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ah4A (A:)
    wimsqtnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqa
    ykikvmdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqy
    niddtlmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsknlnsqiivlwqw
    fdssrqkwiieynetksaytlkcqennryltwiqnsnnyvetyqstdsliqywninyldn
    daskyilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ah4A (A:)
    tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv
    mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt
    lmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsknlnsqiivlwqwfdssr
    qkwiieynetksaytlkcqennryltwiqnsnnyvetyqstdsliqywninyldndasky
    ilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ah4B (B:)
    wimsqtnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqa
    ykikvmdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqy
    niddtlmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsknlnsqiivlwqw
    fdssrqkwiieynetksaytlkcqennryltwiqnsnnyvetyqstdsliqywninyldn
    daskyilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ah4B (B:)
    sqtnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqayki
    kvmdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqynid
    dtlmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsknlnsqiivlwqwfds
    srqkwiieynetksaytlkcqennryltwiqnsnnyvetyqstdsliqywninyldndas
    kyilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli