PDB entry 3ah3

View 3ah3 on RCSB PDB site
Description: Crystal structure of LR5-1, 3-isopropylmalate dehydrogenase created by directed evolution
Class: oxidoreductase
Keywords: 3-isopropylmalate dehydrogenase, homoisocitrate dehydrogenase, directed evolution, OXIDOREDUCTASE
Deposited on 2010-04-13, released 2011-02-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homoisocitrate dehydrogenase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: LR5-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72IW9 (Start-333)
      • see remark 999 (14)
      • see remark 999 (56)
      • see remark 999 (71)
      • see remark 999 (84-85)
      • see remark 999 (207)
      • see remark 999 (216)
      • see remark 999 (237)
      • see remark 999 (309)
    Domains in SCOPe 2.03: d3ah3a_
  • Chain 'B':
    Compound: Homoisocitrate dehydrogenase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: LR5-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72IW9 (Start-333)
      • see remark 999 (14)
      • see remark 999 (56)
      • see remark 999 (71)
      • see remark 999 (84-85)
      • see remark 999 (207)
      • see remark 999 (216)
      • see remark 999 (237)
      • see remark 999 (309)
    Domains in SCOPe 2.03: d3ah3b_
  • Chain 'C':
    Compound: Homoisocitrate dehydrogenase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: LR5-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72IW9 (Start-333)
      • see remark 999 (14)
      • see remark 999 (56)
      • see remark 999 (71)
      • see remark 999 (84-85)
      • see remark 999 (207)
      • see remark 999 (216)
      • see remark 999 (237)
      • see remark 999 (309)
    Domains in SCOPe 2.03: d3ah3c_
  • Chain 'D':
    Compound: Homoisocitrate dehydrogenase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: LR5-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72IW9 (Start-333)
      • see remark 999 (14)
      • see remark 999 (56)
      • see remark 999 (71)
      • see remark 999 (84-85)
      • see remark 999 (207)
      • see remark 999 (216)
      • see remark 999 (237)
      • see remark 999 (309)
    Domains in SCOPe 2.03: d3ah3d_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ah3A (A:)
    mayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkil
    schatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivren
    teglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqg
    lfldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmgg
    lglapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrveka
    vdlvlergpmtpdlggdatteafteavvealksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ah3A (A:)
    ayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkils
    chatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivrent
    eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
    fldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmggl
    glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
    dlvlergpmtpdlggdatteafteavvealksl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ah3B (B:)
    mayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkil
    schatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivren
    teglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqg
    lfldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmgg
    lglapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrveka
    vdlvlergpmtpdlggdatteafteavvealksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ah3B (B:)
    ayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkils
    chatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivrent
    eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
    fldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmggl
    glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
    dlvlergpmtpdlggdatteafteavvealksl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ah3C (C:)
    mayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkil
    schatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivren
    teglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqg
    lfldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmgg
    lglapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrveka
    vdlvlergpmtpdlggdatteafteavvealksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ah3C (C:)
    ayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkils
    chatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivrent
    eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
    fldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmggl
    glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
    dlvlergpmtpdlggdatteafteavvealksl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ah3D (D:)
    mayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkil
    schatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivren
    teglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqg
    lfldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmgg
    lglapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrveka
    vdlvlergpmtpdlggdatteafteavvealksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ah3D (D:)
    ayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkils
    chatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivrent
    eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
    fldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmggl
    glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
    dlvlergpmtpdlggdatteafteavvealksl