PDB entry 3ah1

View 3ah1 on RCSB PDB site
Description: HA1 subcomponent of botulinum type C progenitor toxin complexed with N-acetylneuramic acid
Class: toxin
Keywords: Toxin, beta trefoil, hemagglutinin
Deposited on 2010-04-13, released 2010-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Main hemagglutinin component
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ah1a1, d3ah1a2
  • Chain 'B':
    Compound: Main hemagglutinin component
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46084 (2-287)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d3ah1b1, d3ah1b2, d3ah1b3
  • Heterogens: SLB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ah1A (A:)
    wimsqtnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqa
    ykikvmdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqy
    niddtlmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsknlnsqiivlwqw
    fdssrqkwiieynetksaytlkcqennryltwiqnsnnyvetyqstdsliqywninyldn
    daskyilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ah1A (A:)
    tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv
    mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt
    lmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsknlnsqiivlwqwfdssr
    qkwiieynetksaytlkcqennryltwiqnsnnyvetyqstdsliqywninyldndasky
    ilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ah1B (B:)
    wimsqtnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqa
    ykikvmdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqy
    niddtlmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsknlnsqiivlwqw
    fdssrqkwiieynetksaytlkcqennryltwiqnsnnyvetyqstdsliqywninyldn
    daskyilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli