PDB entry 3agw

View 3agw on RCSB PDB site
Description: Crystal Structure of the Cytoplasmic Domain of G-Protein-Gated Inward Rectifier Potassium Channel Kir3.2 in the absence of Na+
Class: transport protein
Keywords: cytoplasmic assembly, ion channel, beta-barrel, TRANSPORT PROTEIN
Deposited on 2010-04-08, released 2010-09-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G protein-activated inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3agwa_
  • Heterogens: MG, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3agwA (A:)
    gshmrkiqryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnsh
    iveasiraklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfwe
    iskaqlpkeeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdy
    nsfhetyetstpslsakelaelanrael
    

    Sequence, based on observed residues (ATOM records): (download)
    >3agwA (A:)
    iqryvrkdgkcnvhhgnvraetlvfsthavismrdgklclmfrvgdlrnshiveasirak
    likskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpke
    eleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhetyet
    stpslsakelaelanr