PDB entry 3agm

View 3agm on RCSB PDB site
Description: Complex of PKA with the bisubstrate protein kinase inhibitor ARC-670
Class: transferase/transferase inhibitor
Keywords: PKA, protein kinase A, bisubstrate, bisubstrate inhibitor, ARC-670, TRANSFERASE-TRANSFERASE INHIBITOR COMPLEX
Deposited on 2010-04-02, released 2010-09-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Pkaca, Prkaca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3agma_
  • Chain 'B':
    Compound: n~2~-{8-oxo-8-[4-(9h-purin-6-yl)piperazin-1-yl]octanoyl}-d-arginyl-d-arginyl-d-arginyl-d-arginyl-d-arginyl-d-argininamide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3AGM (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3agmA (A:)
    mgnaaaakkgseqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvml
    vkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymv
    meyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgy
    iqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppff
    adqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfat
    tdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3agmA (A:)
    qesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyam
    kildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfsh
    lrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrv
    kgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekiv
    sgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkve
    apfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    No sequence available.