PDB entry 3agl

View 3agl on RCSB PDB site
Description: Complex of PKA with the bisubstrate protein kinase inhibitor ARC-1039
Class: transferase/transferase inhibitor
Keywords: PKA, protein kinase A, bisubstrate inhibitor, ARC-1039, TRANSFERASE-TRANSFERASE INHIBITOR COMPLEX
Deposited on 2010-04-02, released 2010-09-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Pkaca, Prkaca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3agla_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Pkaca, Prkaca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3aglb_
  • Heterogens: A03, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aglA (A:)
    mgnaaaakkgseqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvml
    vkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymv
    meyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgy
    iqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppff
    adqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfat
    tdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aglA (A:)
    seqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhy
    amkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemf
    shlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfak
    rvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyek
    ivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrk
    veapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aglB (B:)
    mgnaaaakkgseqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvml
    vkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymv
    meyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgy
    iqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppff
    adqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfat
    tdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aglB (B:)
    svkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamki
    ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlr
    rigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkg
    rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg
    kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap
    fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef