PDB entry 3agj

View 3agj on RCSB PDB site
Description: Crystal structure of archaeal Pelota and GTP-bound EF1 alpha complex
Class: translation/hydrolase
Keywords: GTP binding, TRANSLATION-HYDROLASE complex
Deposited on 2010-04-01, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3agja4, d3agja5, d3agja6
  • Chain 'B':
    Compound: Protein pelota homolog
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YAZ5 (2-End)
      • expression tag (0-1)
      • conflict (39)
      • conflict (123)
  • Chain 'C':
    Compound: Elongation factor 1-alpha
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3agjc4, d3agjc5, d3agjc6
  • Chain 'D':
    Compound: Protein pelota homolog
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YAZ5 (2-End)
      • expression tag (0-1)
      • conflict (39)
      • conflict (123)
  • Chain 'E':
    Compound: Elongation factor 1-alpha
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3agje4, d3agje5, d3agje6
  • Chain 'F':
    Compound: Protein pelota homolog
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YAZ5 (2-End)
      • expression tag (1)
      • conflict (39)
      • conflict (123)
  • Chain 'G':
    Compound: Elongation factor 1-alpha
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3agjg4, d3agjg5, d3agjg6
  • Chain 'H':
    Compound: Protein pelota homolog
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YAZ5 (2-End)
      • expression tag (0-1)
      • conflict (39)
      • conflict (123)
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3agjA (A:)
    maekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawild
    kmkeerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkg
    efeagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkgl
    gyqvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnv
    ysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavr
    gvsksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriie
    ikakldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvg
    igivtdvkpakvdikak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3agjA (A:)
    kphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkmk
    eerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgefe
    agmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgyq
    vdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnvysi
    pgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavrgvs
    ksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriieika
    kldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigi
    vtdvkpakvdik
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3agjC (C:)
    maekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawild
    kmkeerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkg
    efeagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkgl
    gyqvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnv
    ysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavr
    gvsksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriie
    ikakldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvg
    igivtdvkpakvdikak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3agjC (C:)
    kphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkmk
    eerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgefe
    agmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgyq
    vdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnvysi
    pgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavrgvs
    ksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriieika
    kldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigi
    vtdvkpakvdi
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3agjE (E:)
    maekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawild
    kmkeerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkg
    efeagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkgl
    gyqvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnv
    ysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavr
    gvsksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriie
    ikakldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvg
    igivtdvkpakvdikak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3agjE (E:)
    ekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkm
    keerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgef
    eagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgy
    qvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnvys
    ipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavrgv
    sksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriieik
    akldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgig
    ivtdvkpakv
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3agjG (G:)
    maekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawild
    kmkeerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkg
    efeagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkgl
    gyqvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnv
    ysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavr
    gvsksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriie
    ikakldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvg
    igivtdvkpakvdikak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3agjG (G:)
    ekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkm
    keerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgef
    eagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgy
    qvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnvys
    ipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavrgv
    sksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriieik
    akldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgig
    ivtdvkpakvdi
    

  • Chain 'H':
    No sequence available.