PDB entry 3ag7

View 3ag7 on RCSB PDB site
Description: An auxilin-like J-domain containing protein, JAC1 J-domain
Class: plant protein
Keywords: J-domain, An auxilin-like J-domain containing protein, JAC1, CHLOROPLAST ACCUMULATION RESPONSE, PLANT PROTEIN
Deposited on 2010-03-24, released 2010-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein F9E10.5
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g75100, F9E10.5, JAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C9Q4 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d3ag7a1, d3ag7a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ag7A (A:)
gplgseeiknidakirkwssgksgnirsllstlqyilwsgsgwkpvplmdmiegnavrks
yqrallilhpdklqqkgasanqkymaekvfellqeawdhfntlgpv

    Sequence, based on observed residues (ATOM records): (download) 
    >3ag7A (A:)
gplgseeiknidakirkwssgksgnirsllstlqyilwsgsgwkpvplmdmiegnavrks
yqrallilhpdklqqkgasanqkymaekvfellqeawdhfntlgp