PDB entry 3ag6

View 3ag6 on RCSB PDB site
Description: Crystal Structure of Pantothenate Synthetase from Staphylococcus aureus in complex with pantoyl adenylate
Class: ligase
Keywords: pantothenate synthetase, ATP-dependent enzyme, ATP-binding, Ligase, Nucleotide-binding, Pantothenate biosynthesis
Deposited on 2010-03-19, released 2010-07-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.201
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate synthetase
    Species: STAPHYLOCOCCUS AUREUS [TaxId:93061]
    Gene: panC, SAOUHSC_02918
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ag6a_
  • Chain 'B':
    Compound: Pantothenate synthetase
    Species: STAPHYLOCOCCUS AUREUS [TaxId:93061]
    Gene: panC, SAOUHSC_02918
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ag6b_
  • Heterogens: PAJ, ACY, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ag6A (A:)
    mtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditivsvfvnp
    lqfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlega
    krpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivrea
    dglakssrnvylteqerqeavhlskslllaqalyqdgerqskviidrvteyleshiseri
    eevavysypqlveqheitgrifislavkfskarlidniiigae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ag6B (B:)
    mtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditivsvfvnp
    lqfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlega
    krpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivrea
    dglakssrnvylteqerqeavhlskslllaqalyqdgerqskviidrvteyleshiseri
    eevavysypqlveqheitgrifislavkfskarlidniiigae