PDB entry 3ag5

View 3ag5 on RCSB PDB site
Description: Crystal Structure of Pantothenate Synthetase from Staphylococcus aureus
Class: ligase
Keywords: pantothenate synthetase, open/close mechanism, ATP-dependent enzyme, ATP-binding, Ligase, Nucleotide-binding, Pantothenate biosynthesis
Deposited on 2010-03-19, released 2010-07-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate synthetase
    Species: STAPHYLOCOCCUS AUREUS [TaxId:93061]
    Gene: panC, SAOUHSC_02918
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ag5a_
  • Chain 'B':
    Compound: Pantothenate synthetase
    Species: STAPHYLOCOCCUS AUREUS [TaxId:93061]
    Gene: panC, SAOUHSC_02918
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ag5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ag5A (A:)
    mtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditivsvfvnp
    lqfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlega
    krpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivrea
    dglakssrnvylteqerqeavhlskslllaqalyqdgerqskviidrvteyleshiseri
    eevavysypqlveqheitgrifislavkfskarlidniiigae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag5A (A:)
    mtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditivsvfvnp
    lqfgdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlegakrpgh
    fdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivreadglak
    ssrnvylteqerqeavhlskslllaqalyqdgerqskviidrvteyleshiserieevav
    ysypqlveqheitgrifislavkfskarlidniiigae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ag5B (B:)
    mtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditivsvfvnp
    lqfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlega
    krpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivrea
    dglakssrnvylteqerqeavhlskslllaqalyqdgerqskviidrvteyleshiseri
    eevavysypqlveqheitgrifislavkfskarlidniiigae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag5B (B:)
    mtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditivsvfvnp
    lqfdfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlegakrpg
    hfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivreadgla
    kssrnvylteqerqeavhlskslllaqalyqdgerqskviidrvteyleshiserieeva
    vysypqlveqheitgrifislavkfskarlidniiigae