PDB entry 3ag0

View 3ag0 on RCSB PDB site
Description: Crystal structure of carbonmonoxy humnan cytoglobin
Class: oxygen transport
Keywords: Globins, Heme, Carbon Monoxide, Complex, Ligands, hexacoordination, bis-His, Disulfide bond, Iron, Metal-binding, Oxygen transport, Transport
Deposited on 2010-03-17, released 2011-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.215
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene: CYGB, STAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ag0a_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ag0A (A:)
    gsmekvpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsakq
    yfsqfkhmedplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhk
    vepvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpna
    ttppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag0A (A:)
    elseaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgwvqqv