PDB entry 3afv

View 3afv on RCSB PDB site
Description: Dye-decolorizing peroxidase (DyP) at 1.4 A resolution
Class: oxidoreductase
Keywords: dyp, dye-decolorizing peroxidase, beta barrel, OXIDOREDUCTASE, aspartic acid
Deposited on 2010-03-11, released 2011-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DyP
    Species: Bjerkandera adusta [TaxId:5331]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3afva_
  • Heterogens: HEM, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3afvA (A:)
    andtilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdps
    qqplafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgv
    fligsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtg
    wettvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaip
    ansagnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltde
    trcpfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyq
    siigngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfv
    ipkggeyfflpsisaltatiaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3afvA (A:)
    tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp
    lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli
    gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtgwet
    tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans
    agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc
    pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii
    gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk
    ggeyfflpsisaltatiaa