PDB entry 3afr

View 3afr on RCSB PDB site
Description: Crystal Structure of VDR-LBD/22S-Butyl-1a,24R-dihydroxyvitamin D3 complex
Class: TRANSCRIPTION/Transcription regulator
Keywords: Vitamin D Receptor, nuclear receptor, agonist, antagonist, vitamin D derivative, DNA-binding, Nucleus, Receptor, Transcription, Transcription regulation, TRANSCRIPTION-Transcription regulator complex
Deposited on 2010-03-10, released 2010-03-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3afra_
  • Chain 'C':
    Compound: 13-meric peptide from Mediator of RNA polymerase II transcription subunit 1
    Species: Xenopus tropicalis, synthetic [TaxId:8364]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ICJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3afrA (A:)
    gshmgspnsplkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgs
    vtldlsplsmlphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsn
    qsftmddmswdcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmai
    civspdrpgvqdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslnee
    hskqyrslsfqpensmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3afrA (A:)
    klseeqqhiiailldahhktydptyadfrdfrppvrmsplsmlphladlvsysiqkvigf
    akmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskag
    htlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlq
    tyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgn
    

  • Chain 'C':
    No sequence available.