PDB entry 3afk

View 3afk on RCSB PDB site
Description: Crystal Structure of Agrocybe aegerita lectin AAL complexed with Thomsen-Friedenreich antigen
Class: hydrolase
Keywords: galectin, AAL, Thomsen-Friedenreich antigen, Apoptosis, Hydrolase, Lectin, Nuclease, GAL-BETA-1,3-GALNAC-ALPHA-O-THR
Deposited on 2010-03-09, released 2010-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (1-158)
      • expression tag (0)
      • see remark 999 (132)
      • expression tag (159-166)
    Domains in SCOPe 2.06: d3afka1, d3afka2, d3afka3
  • Chain 'B':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (1-158)
      • expression tag (0)
      • see remark 999 (132)
      • expression tag (159-165)
    Domains in SCOPe 2.06: d3afkb1, d3afkb2, d3afkb3
  • Heterogens: THR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3afkA (A:)
    mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytglalehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3afkB (B:)
    mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytglalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3afkB (B:)
    mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytglalehhhhh