PDB entry 3afi

View 3afi on RCSB PDB site
Description: Crystal structure of DBJA (HIS-DBJA)
Class: hydrolase
Keywords: a/b-hydrolase, hydrolase
Deposited on 2010-03-02, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59337
      • expression tag (313-315)
    Domains in SCOPe 2.07: d3afia1, d3afia2
  • Chain 'B':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59337
      • expression tag (313-315)
    Domains in SCOPe 2.07: d3afib1, d3afib2
  • Chain 'E':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59337
      • expression tag (313-315)
    Domains in SCOPe 2.07: d3afie1, d3afie2
  • Chain 'F':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59337
      • expression tag (313-315)
    Domains in SCOPe 2.07: d3afif1, d3afif2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3afiA (A:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafverv
    lpggivrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaas
    sypkllftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiag
    ieavrpqlaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3afiA (A:)
    irrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgq
    sgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmef
    irpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrk
    lgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllft
    gepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrphh
    h
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3afiB (B:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafverv
    lpggivrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaas
    sypkllftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiag
    ieavrpqlaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3afiB (B:)
    eieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdlig
    fgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglaf
    mefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggi
    vrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkl
    lftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavh
    hh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3afiE (E:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafverv
    lpggivrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaas
    sypkllftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiag
    ieavrpqlaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3afiE (E:)
    rrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgqs
    gkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmefi
    rpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrkl
    gdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftg
    epgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrpqhh
    h
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3afiF (F:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafverv
    lpggivrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaas
    sypkllftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiag
    ieavrpqlaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3afiF (F:)
    rrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgqs
    gkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmefi
    rpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrkl
    gdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftg
    epgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrphhh