PDB entry 3aex

View 3aex on RCSB PDB site
Description: Catalytic intermediate analogue of threonine synthase from Thermus thermophilus HB8
Class: lyase
Keywords: Threonine synthase, PLP, Pyridoxal phosphate, LYASE
Deposited on 2010-02-13, released 2010-11-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0491
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: threonine synthase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0491
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3aexb_
  • Heterogens: AN7, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aexB (B:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll