PDB entry 3aev

View 3aev on RCSB PDB site
Description: Crystal structure of a/eIF2alpha-aDim2p-rRNA complex from Pyrococcus horikoshii OT3
Class: translation/RNA binding protein/RNA
Keywords: Proteins-rRNA complex, 16S rRNA, RNA-binding, RNA processing, Initiation factor, Protein biosynthesis, TRANSLATION-RNA BINDING PROTEIN-RNA complex
Deposited on 2010-02-10, released 2010-04-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit alpha
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0961
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative uncharacterized protein PH1566
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1566
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3aevb1, d3aevb2
  • Chain 'C':
    Compound: RNA (5'-r(*gp*gp*ap*up*cp*ap*cp*cp*up*cp*c)-3')

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aevB (B:)
    mgeefeklmkkfenvnkdgeivededeweeffkqeeyvkipkdriavligkkgqtkkeie
    krtktkitidsetgevwitstketedplavwkardivlaigrgfsperafrllnegeyle
    iinltdiiigneknalprvrgriigrkgrtrqiieemsgasvsvygktvaiignpiqiei
    aktaieklargsphgsvyrylerrkkdlelegamyyenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aevB (B:)
    deweeffkqeeyvkipkdriavligkkgqtkkeiekrtktkitidsetgevwitstkete
    dplavwkardivlaigrgfsperafrllnegeyleiinltdiialprvrgriigrkgrtr
    qiieemsgasvsvygktvaiignpiqieiaktaieklargsphgsvyrylerrkkdl
    

  • Chain 'C':
    No sequence available.