PDB entry 3ael

View 3ael on RCSB PDB site
Description: Reaction intermediate structure of Entamoeba histolytica methionine gamma-lyase 1 containing methionine imine-pyridoxamine-5'-phosphate and alpha-amino-alpha, beta-butenoic acid-pyridoxal-5'-phosphate
Class: lyase
Keywords: gamma-lyase, L-methionine, entamoeba histolytica, lyase
Deposited on 2010-02-10, released 2011-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: metG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.07: d3aela_
  • Chain 'B':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: metG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.07: d3aelb_
  • Chain 'C':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: metG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.07: d3aelc_
  • Chain 'D':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: metG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.07: d3aeld_
  • Heterogens: 4LM, MEE, SO4, GOL, 2LM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aelA (A:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aelA (A:)
    aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
    qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
    gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
    ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
    mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
    ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
    pelvrisvgienvddiiadlkqalelw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aelB (B:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aelB (B:)
    aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
    qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
    gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
    ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
    mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
    ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
    pelvrisvgienvddiiadlkqalel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3aelC (C:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aelC (C:)
    aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
    qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
    gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
    ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
    mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
    ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
    pelvrisvgienvddiiadlkqalelw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3aelD (D:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aelD (D:)
    ditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptveqf
    eemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprfgi
    evdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdatft
    spcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmapmd
    aflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtgyg
    stflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgitpe
    lvrisvgienvddiiadlkqalel