PDB entry 3aef

View 3aef on RCSB PDB site
Description: Crystal structure of porcine heart mitochondrial complex II with an empty quinone-binding pocket
Class: oxidoreductase
Keywords: respiratory complex II, inhibitors, Electron transport, Iron, Iron-sulfur, Metal-binding, Mitochondrion, Mitochondrion inner membrane, Oxidoreductase, Transit peptide, Transport, Tricarboxylic acid cycle, Heme, Transmembrane, FAD-binding protein
Deposited on 2010-02-04, released 2011-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3aefa1, d3aefa2, d3aefa3
  • Chain 'B':
    Compound: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3aefb1, d3aefb2
  • Chain 'C':
    Compound: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3aefc_
  • Chain 'D':
    Compound: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3aefd_
  • Heterogens: FAD, FES, SF4, F3S, HEM, EPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aefA (A:)
    ssakvsdaistqypvvdhefdavvvgaggaglraafglseagfntacvtklfptrshtva
    aqgginaalgnmeednwrwhfydtvkgsdwlgdqdaihymteqapasvvelenygmpfsr
    tedgkiyqrafggqslkfgkggqahrcccvadrtghsllhtlygrslrydtsyfveyfal
    dllmengecrgvialciedgsihrirarntvvatggygrtyfsctsahtstgdgtamvtr
    aglpcqdlefvqfhptgiygagclitegcrgeggilinsqgerfmeryapvakdlasrdv
    vsrsmtleiregrgcgpekdhvylqlhhlppeqlavrlpgisetamifagvdvtkepipv
    lptvhynmggiptnykgqvlrhvngqdqvvpglyacgeaacasvhganrlganslldlvv
    fgracalsiaescrpgdkvpsikpnageesvmnldklrfangtirtselrlsmqksmqsh
    aavfrvgsvlqegcekilrlygdlqhlktfdrgmvwntdlvetlelqnlmlcalqtiyga
    earkesrgaharedfkervdeydyskpiqgqqkkpfqehwrkhtlsyvdvktgkvsleyr
    pvidktlneadcatvppairsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aefA (A:)
    stqypvvdhefdavvvgaggaglraafglseagfntacvtklfptrshtvaaqgginaal
    gnmeednwrwhfydtvkgsdwlgdqdaihymteqapasvvelenygmpfsrtedgkiyqr
    afggqslkfgkggqahrcccvadrtghsllhtlygrslrydtsyfveyfaldllmengec
    rgvialciedgsihrirarntvvatggygrtyfsctsahtstgdgtamvtraglpcqdle
    fvqfhptgiygagclitegcrgeggilinsqgerfmeryapvakdlasrdvvsrsmtlei
    regrgcgpekdhvylqlhhlppeqlavrlpgisetamifagvdvtkepipvlptvhynmg
    giptnykgqvlrhvngqdqvvpglyacgeaacasvhganrlganslldlvvfgracalsi
    aescrpgdkvpsikpnageesvmnldklrfangtirtselrlsmqksmqshaavfrvgsv
    lqegcekilrlygdlqhlktfdrgmvwntdlvetlelqnlmlcalqtiygaearkesrga
    haredfkervdeydyskpiqgqqkkpfqehwrkhtlsyvdvktgkvsleyrpvidktlne
    adcatvppairsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aefB (B:)
    aqtaaataprikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstlt
    frrscregicgscamninggntlactrridtnldkvskiyplphmyvikdlvpdlsnfya
    qyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwngdkylg
    pavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgkaiaeikk
    mmatykekkasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aefB (B:)
    prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
    icgscamninggntlactrridtnldkvskiyplphmyvikdlvpdlsnfyaqyksiepy
    lkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwngdkylgpavlmqay
    rwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgkaiaeikkmmatyke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3aefC (C:)
    lgttakeemerfwnknlgsnrplsphitiyrwslpmamsichrgtgialsagvslfglsa
    lllpgnfeshlelvkslclgptliytakfgivfplmyhtwngirhliwdlgkgltipqlt
    qsgvvvliltvlssvglaam
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aefC (C:)
    ttakeemerfwnknlgsnrplsphitiyrwslpmamsichrgtgialsagvslfglsall
    lpgnfeshlelvkslclgptliytakfgivfplmyhtwngirhliwdlgkgltipqltqs
    gvvvliltvlssvglaam
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3aefD (D:)
    asskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvr
    gdalqkaakagllalsaftfaglcyfnyhdvgickavamlwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aefD (D:)
    sskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrg
    dalqkaakagllalsaftfaglcyfnyhdvgickavamlwkl