PDB entry 3adl

View 3adl on RCSB PDB site
Description: Structure of TRBP2 and its molecule implications for miRNA processing
Class: gene regulation/RNA
Keywords: TRBP2, miRNA processing, GENE REGULATION-RNA complex
Deposited on 2010-01-22, released 2010-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.263
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RISC-loading complex subunit TARBP2
    Species: Homo sapiens [TaxId:9606]
    Gene: TARBP2, TRBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15633 (17-End)
      • expression tag (8-16)
    Domains in SCOPe 2.06: d3adla1, d3adla2
  • Chain 'B':
    Compound: RNA (5'-r(p*cp*gp*cp*gp*cp*gp*cp*gp*cp*g)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: RNA (5'-r(p*cp*gp*cp*gp*cp*gp*cp*gp*cp*g)-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3adlA (A:)
    hhhhhhssglvprgshevgalqelvvqkgwrlpeytvtqesgpahrkeftmtcrverfie
    igsgtskklakrnaaakmllrvhtvpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3adlA (A:)
    glvprgshevgalqelvvqkgwrlpeytvtqesgpahrkeftmtcrverfieigsgtskk
    lakrnaaakmllrvht
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.