PDB entry 3adl

View 3adl on RCSB PDB site
Description: Structure of TRBP2 and its molecule implications for miRNA processing
Class: gene regulation/RNA
Keywords: TRBP2, miRNA processing, GENE REGULATION-RNA complex
Deposited on 2010-01-22, released 2010-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.263
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RISC-loading complex subunit TARBP2
  Species: Homo sapiens [TaxId:9606]
  Gene: TARBP2, TRBP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15633 (17-End)
    • expression tag (8-16)
  Domains in SCOPe 2.08: d3adla1, d3adla2
• Chain 'B':
  Compound: RNA (5'-r(p*cp*gp*cp*gp*cp*gp*cp*gp*cp*g)-3')
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: RNA (5'-r(p*cp*gp*cp*gp*cp*gp*cp*gp*cp*g)-3')
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3adlA (A:)
  hhhhhhssglvprgshevgalqelvvqkgwrlpeytvtqesgpahrkeftmtcrverfie
  igsgtskklakrnaaakmllrvhtvpld
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3adlA (A:)
  glvprgshevgalqelvvqkgwrlpeytvtqesgpahrkeftmtcrverfieigsgtskk
  lakrnaaakmllrvht
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.