PDB entry 3adj

View 3adj on RCSB PDB site
Description: Structure of Arabidopsis HYL1 and its molecular implications for miRNA processing
Deposited on 2010-01-22, released 2010-05-26
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.261
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F21M12.9 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04492 (3-End)
      • expression tag (2)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3adjA (A:)
    gshglcknllqeyaqkmnyaiplyqcqkvetlgrvtqftctveiggikytgaatrtkkda
    eisagrtallaiqsdt
    

    Sequence, based on observed residues (ATOM records):
    >3adjA (A:)
    hglcknllqeyaqkmnyaiplyqcqkvetlgrvtqftctveiggikytgaatrtkkdaei
    sagrtallaiqs