PDB entry 3ade

View 3ade on RCSB PDB site
Description: Crystal Structure of Keap1 in Complex with Sequestosome-1/p62
Class: transcription
Keywords: beta-propeller, kelch motif, transcription
Deposited on 2010-01-19, released 2010-03-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.178
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Inrf2, Keap1, Kiaa0132
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3adea_
  • Chain 'B':
    Compound: Sequestosome-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3adeA (A:)
    mtlhkptqavpcrapkvgrliytaggyfrqslsyleaynpsngswlrladlqvprsglag
    cvvggllyavggrnnspdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiya
    vggshgcihhssveryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsa
    ecyypernewrmitpmntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfv
    apmrhhrsalgitvhqgkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgva
    vtmepcrkqidqqnctcy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3adeA (A:)
    grliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnnsp
    dgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssverye
    perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpmn
    tirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhqg
    kiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc
    

  • Chain 'B':
    No sequence available.