PDB entry 3ad5

View 3ad5 on RCSB PDB site
Description: Crystal structure of Triazolone derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
Class: transferase
Keywords: tyrosine-protein kinase, ATP-binding, phosphorylation, signal transduction, kinase, sh2 domain, sh3 domain, transferase
Deposited on 2010-01-14, released 2011-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ad5a_
  • Heterogens: SO4, DMS, MPD, 5PB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ad5A (A:)
    qtqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspda
    flaeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldm
    aaqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpi
    kwtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdn
    cpeelyqlmrlcwkerpedrptfdylrsvledfftategqyqpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ad5A (A:)
    qkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaea
    nlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqia
    egmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtap
    eainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeel
    yqlmrlcwkerpedrptfdylrsvledfftate