PDB entry 3acz

View 3acz on RCSB PDB site
Description: Crystal structure of Entamoeba histolytica methionine gamma-lyase 1
Class: lyase
Keywords: gamma-lyase, L-methionine, entamoeba histolytica, Lyase
Deposited on 2010-01-13, released 2011-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.07: d3acza_
  • Chain 'B':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.07: d3aczb_
  • Chain 'C':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.07: d3aczc_
  • Chain 'D':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.07: d3aczd_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aczA (A:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aczA (A:)
    aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
    qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
    gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
    ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
    mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
    ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
    pelvrisvgienvddiiadlkqalelw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aczB (B:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aczB (B:)
    aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
    qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
    gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
    ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
    mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
    ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
    pelvrisvgienvddiiadlkqalel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3aczC (C:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aczC (C:)
    aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
    qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
    gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
    ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
    mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
    ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
    pelvrisvgienvddiiadlkqalelw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3aczD (D:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aczD (D:)
    ditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptveqf
    eemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprfgi
    evdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdatft
    spcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmapmd
    aflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtgyg
    stflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgitpe
    lvrisvgienvddiiadlkqalel