PDB entry 3ac4

View 3ac4 on RCSB PDB site
Description: Crystal structure of triazolo pyrimidine derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
Class: transferase
Keywords: tyrosine-protein kinase, ATP-binding, phosphorylation, signal transduction, kinase, sh2 domain, sh3 domain, transferase
Deposited on 2009-12-28, released 2010-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ac4a_
  • Heterogens: SO4, DMS, KZL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ac4A (A:)
    qtqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspda
    flaeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldm
    aaqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpi
    kwtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdn
    cpeelyqlmrlcwkerpedrptfdylrsvledfftategqyqpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ac4A (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
    lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
    gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
    ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
    qlmrlcwkerpedrptfdylrsvledfftate