PDB entry 3ac0

View 3ac0 on RCSB PDB site
Description: Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose
Class: hydrolase
Keywords: Glycoside hydrolase family3 beta-glucosidase, PA14 domain, HYDROLASE
Deposited on 2009-12-25, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.173
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase I
    Species: Kluyveromyces marxianus [TaxId:4911]
    Gene: Bgl, bglI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ac0a1, d3ac0a2, d3ac0a3, d3ac0a4
  • Chain 'B':
    Compound: Beta-glucosidase I
    Species: Kluyveromyces marxianus [TaxId:4911]
    Gene: Bgl, bglI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ac0b1, d3ac0b2, d3ac0b3, d3ac0b4
  • Chain 'C':
    Compound: Beta-glucosidase I
    Species: Kluyveromyces marxianus [TaxId:4911]
    Gene: Bgl, bglI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ac0c1, d3ac0c2, d3ac0c3, d3ac0c4
  • Chain 'D':
    Compound: Beta-glucosidase I
    Species: Kluyveromyces marxianus [TaxId:4911]
    Gene: Bgl, bglI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ac0d1, d3ac0d2, d3ac0d3, d3ac0d4
  • Heterogens: BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ac0A (A:)
    mskfdveqllselnqdekisllsavdfwhtkkierlgipavrvsdgpngirgtkffdgvp
    sgcfpngtglastfdrdlletagklmakesiaknaavilgpttnmqrgplggrgfesfse
    dpylagmatssvvkgmqgegiaatvkhfvcndledqrfssnsivseralreiylepfrla
    vkhanpvcimtaynkvngehcsqskkllidilrdewkwdgmlmsdwfgtyttaaaikngl
    diefpgptrwrtralvshslnsreqittedvddrvrqvlkmikfvvdnlektgivengpe
    stsnntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasmn
    syyvvspyegivnklgkevdytvgayshksigglaesslidaakpadaensgliakfysn
    pveersddeepfhvtkvnrsnvhlfdfkhekvdpknpyffvtltgqyvpqedgdyifslq
    vygsglfylndeliidqkhnqergsfcfgagtkertkkltlkkgqvynvrveygsgptsg
    lvgefgaggfqagvikaidddeeirnaaelaakhdkavliiglngewetegydrenmdlp
    krtnelvravlkanpntvivnqsgtpvefpwledanalvqawyggnelgnaiadvlygdv
    vpngklslswpfklqdnpaflnfktefgrviygedifvgyryyeklqrkvafpfgyglsy
    ttfeldisdfkvtddkiaisvdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekv
    hlepgekktvnidlelkdaisyfneelgkwhveageylvsvgtssddilsvkefkvekel
    ywkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ac0A (A:)
    skfdveqllselnqdekisllsavdfwhtkkierlgipavrvsdgpngirgtkffdgvps
    gcfpngtglastfdrdlletagklmakesiaknaavilgpttnmqrgplggrgfesfsed
    pylagmatssvvkgmqgegiaatvkhfvcndledqrfssnsivseralreiylepfrlav
    khanpvcimtaynkvngehcsqskkllidilrdewkwdgmlmsdwfgtyttaaaikngld
    iefpgptrwrtralvshslnsreqittedvddrvrqvlkmikfvvdnlektgivengpes
    tsnntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasmns
    yyvvspyegivnklgkevdytvgayshksigglaesslidaakpadaensgliakfysnp
    veersddeepfhvtkvnrsnvhlfdfkhekvdpknpyffvtltgqyvpqedgdyifslqv
    ygsglfylndeliidqkhnqergsfcfgagtkertkkltlkkgqvynvrveygsgptsge
    fgaggfqagvikaidddeeirnaaelaakhdkavliiglngewetegydrenmdlpkrtn
    elvravlkanpntvivnqsgtpvefpwledanalvqawyggnelgnaiadvlygdvvpng
    klslswpfklqdnpaflnfktefgrviygedifvgyryyeklqrkvafpfgyglsyttfe
    ldisdfkvtddkiaisvdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekvhlep
    gekktvnidlelkdaisyfneelgkwhveageylvsvgtssddilsvkefkvekelywkg
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ac0B (B:)
    mskfdveqllselnqdekisllsavdfwhtkkierlgipavrvsdgpngirgtkffdgvp
    sgcfpngtglastfdrdlletagklmakesiaknaavilgpttnmqrgplggrgfesfse
    dpylagmatssvvkgmqgegiaatvkhfvcndledqrfssnsivseralreiylepfrla
    vkhanpvcimtaynkvngehcsqskkllidilrdewkwdgmlmsdwfgtyttaaaikngl
    diefpgptrwrtralvshslnsreqittedvddrvrqvlkmikfvvdnlektgivengpe
    stsnntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasmn
    syyvvspyegivnklgkevdytvgayshksigglaesslidaakpadaensgliakfysn
    pveersddeepfhvtkvnrsnvhlfdfkhekvdpknpyffvtltgqyvpqedgdyifslq
    vygsglfylndeliidqkhnqergsfcfgagtkertkkltlkkgqvynvrveygsgptsg
    lvgefgaggfqagvikaidddeeirnaaelaakhdkavliiglngewetegydrenmdlp
    krtnelvravlkanpntvivnqsgtpvefpwledanalvqawyggnelgnaiadvlygdv
    vpngklslswpfklqdnpaflnfktefgrviygedifvgyryyeklqrkvafpfgyglsy
    ttfeldisdfkvtddkiaisvdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekv
    hlepgekktvnidlelkdaisyfneelgkwhveageylvsvgtssddilsvkefkvekel
    ywkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ac0B (B:)
    kfdveqllselnqdekisllsavdfwhtkkierlgipavrvsdgpngirgtkffdgvpsg
    cfpngtglastfdrdlletagklmakesiaknaavilgpttnmqrgplggrgfesfsedp
    ylagmatssvvkgmqgegiaatvkhfvcndledqrfssnsivseralreiylepfrlavk
    hanpvcimtaynkvngehcsqskkllidilrdewkwdgmlmsdwfgtyttaaaikngldi
    efpgptrwrtralvshslnsreqittedvddrvrqvlkmikfvvdnlektgivengpest
    snntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasmnsy
    yvvspyegivnklgkevdytvgayshksigglaesslidaakpadaensgliakfysnpr
    sddeepfhvtkvnrsnvhlfkhekvdpknpyffvtltgqyvpqedgdyifslqvygsglf
    ylndeliidqkhnqerggagtkertkkltlkkgqvynvrveygsgpaggfqagvikaidd
    deeirnaaelaakhdkavliiglngewetegydrenmdlpkrtnelvravlkanpntviv
    nqsgtpvefpwledanalvqawyggnelgnaiadvlygdvvpngklslswpfklqdnpaf
    lnfktefgrviygedifvgyryyeklqrkvafpfgyglsyttfeldisdfkvtddkiais
    vdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekvhlepgekktvnidlelkdai
    syfneelgkwhveageylvsvgtssddilsvkefkvekelywkgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ac0C (C:)
    mskfdveqllselnqdekisllsavdfwhtkkierlgipavrvsdgpngirgtkffdgvp
    sgcfpngtglastfdrdlletagklmakesiaknaavilgpttnmqrgplggrgfesfse
    dpylagmatssvvkgmqgegiaatvkhfvcndledqrfssnsivseralreiylepfrla
    vkhanpvcimtaynkvngehcsqskkllidilrdewkwdgmlmsdwfgtyttaaaikngl
    diefpgptrwrtralvshslnsreqittedvddrvrqvlkmikfvvdnlektgivengpe
    stsnntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasmn
    syyvvspyegivnklgkevdytvgayshksigglaesslidaakpadaensgliakfysn
    pveersddeepfhvtkvnrsnvhlfdfkhekvdpknpyffvtltgqyvpqedgdyifslq
    vygsglfylndeliidqkhnqergsfcfgagtkertkkltlkkgqvynvrveygsgptsg
    lvgefgaggfqagvikaidddeeirnaaelaakhdkavliiglngewetegydrenmdlp
    krtnelvravlkanpntvivnqsgtpvefpwledanalvqawyggnelgnaiadvlygdv
    vpngklslswpfklqdnpaflnfktefgrviygedifvgyryyeklqrkvafpfgyglsy
    ttfeldisdfkvtddkiaisvdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekv
    hlepgekktvnidlelkdaisyfneelgkwhveageylvsvgtssddilsvkefkvekel
    ywkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ac0C (C:)
    kfdveqllselnqdekisllsavdfwhtkkierlgipavrvsdgpngirgtkffdgvpsg
    cfpngtglastfdrdlletagklmakesiaknaavilgpttnmqrgplggrgfesfsedp
    ylagmatssvvkgmqgegiaatvkhfvcndledqrfssnsivseralreiylepfrlavk
    hanpvcimtaynkvngehcsqskkllidilrdewkwdgmlmsdwfgtyttaaaikngldi
    efpgptrwrtralvshslnsreqittedvddrvrqvlkmikfvvdnlektgivengpest
    snntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasmnsy
    yvvspyegivnklgkevdytvgayshksigglaesslidaakpensgliakfysnpveer
    sddeepfhvtkvnrsnvhlfdfkhvdpknpyffvtltgqyvpqedgdyifslqvygsglf
    ylndeliidqkqergsfcfgagtkertkkltlkkgqvynvrveygsgptsfgaggfqagv
    ikaidddeeirnaaelaakhdkavliiglngewetegydrenmdlpkrtnelvravlkan
    pntvivnqsgtpvefpwledanalvqawyggnelgnaiadvlygdvvpngklslswpfkl
    qdnpaflnfktefgrviygedifvgyryyeklqrkvafpfgyglsyttfeldisdfkvtd
    dkiaisvdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekvhlepgekktvnidl
    elkdaisyfneelgkwhveageylvsvgtssddilsvkefkvekelywkgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ac0D (D:)
    mskfdveqllselnqdekisllsavdfwhtkkierlgipavrvsdgpngirgtkffdgvp
    sgcfpngtglastfdrdlletagklmakesiaknaavilgpttnmqrgplggrgfesfse
    dpylagmatssvvkgmqgegiaatvkhfvcndledqrfssnsivseralreiylepfrla
    vkhanpvcimtaynkvngehcsqskkllidilrdewkwdgmlmsdwfgtyttaaaikngl
    diefpgptrwrtralvshslnsreqittedvddrvrqvlkmikfvvdnlektgivengpe
    stsnntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasmn
    syyvvspyegivnklgkevdytvgayshksigglaesslidaakpadaensgliakfysn
    pveersddeepfhvtkvnrsnvhlfdfkhekvdpknpyffvtltgqyvpqedgdyifslq
    vygsglfylndeliidqkhnqergsfcfgagtkertkkltlkkgqvynvrveygsgptsg
    lvgefgaggfqagvikaidddeeirnaaelaakhdkavliiglngewetegydrenmdlp
    krtnelvravlkanpntvivnqsgtpvefpwledanalvqawyggnelgnaiadvlygdv
    vpngklslswpfklqdnpaflnfktefgrviygedifvgyryyeklqrkvafpfgyglsy
    ttfeldisdfkvtddkiaisvdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekv
    hlepgekktvnidlelkdaisyfneelgkwhveageylvsvgtssddilsvkefkvekel
    ywkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ac0D (D:)
    kfdveqllselnqdekisllsavdfwhtkkierlgipavrvsdgpngirgtkffdgvpsg
    cfpngtglastfdrdlletagklmakesiaknaavilgpttnmqrgplggrgfesfsedp
    ylagmatssvvkgmqgegiaatvkhfvcndledqrfssnsivseralreiylepfrlavk
    hanpvcimtaynkvngehcsqskkllidilrdewkwdgmlmsdwfgtyttaaaikngldi
    efpgptrwrtralvshslnsreqittedvddrvrqvlkmikfvvdnlektgivengpest
    snntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasmnsy
    yvvspyegivnklgkevdytvgayshksigglaesslidaakpadaensgliakfysnpv
    pfhvtkvnrsnvhlfdfkhekvdpknpyffvtltgqyvpqedgdyifslqvygsglfyln
    deliidqkhnqergsfcfgagtkertkkltlkkgqvynvrveygsgptsgaggfqagvik
    aidddeeirnaaelaakhdkavliiglngewetegydrenmdlpkrtnelvravlkanpn
    tvivnqsgtpvefpwledanalvqawyggnelgnaiadvlygdvvpngklslswpfklqd
    npaflnfktefgrviygedifvgyryyeklqrkvafpfgyglsyttfeldisdfkvtddk
    iaisvdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekvhlepgekktvnidlel
    kdaisyfneelgkwhveageylvsvgtssddilsvkefkvekelywkgl